PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG034227.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family NF-YC
Protein Properties Length: 128aa    MW: 14823.7 Da    PI: 4.9384
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG034227.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC551.8e-17731254597
        NF-YC  45 vllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivp 97 
                  +  + acelfileltlr+wl++ ++k r+l+++di+ a+ + ++ dfl  + p
  CCG034227.1  73 ISNATACELFILELTLRAWLQTTDCKHRALQRCDISRATRQENMLDFLNRVAP 125
                  55689*******************************************98777 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471133.03E-965125IPR009072Histone-fold
Gene3DG3DSA:1.10.20.105.2E-1175123IPR009072Histone-fold
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 128 aa     Download sequence    Send to blast
MSSSHQSEAG SEAKRVLKDL NQSMQFDLAV DDPSAQVENV LPMNSSMLPY HQATEEHRRQ  60
DLELFWIRQL SEISNATACE LFILELTLRA WLQTTDCKHR ALQRCDISRA TRQENMLDFL  120
NRVAPYEI
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2090412e-51AC209041.1 Populus trichocarpa clone POP051-F04, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006383397.13e-38hypothetical protein POPTR_0005s15090g
TrEMBLU5GG153e-38U5GG15_POPTR; Uncharacterized protein
STRINGPOPTR_0005s15090.11e-29(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF143991518
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G56170.26e-13nuclear factor Y, subunit C2